Product Name: Anti-GLRA1 antibody produced in rabbit

Synonym: Anti-Glycine receptor, α 1 (startle disease/hyperekplexia, stiff man syndrome)

Product Type: Chemical

CAS NO: 113082-99-8ROR inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 51 kDa
NCBI accession no.
NP_000162
Shipped in: wet ice
species reactivity
bovine, guinea pig, horse, human, mouse, canine, zebrafish, rat, rabbit
Storage temp.: −20°C
Application: Anti-GLRA1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
GLRA1 is a subunit of pentameric, postsynaptic, inhibitory glycine receptor in the central nervous system. Mutations in gene encoding GLRA1 have been observed to cause startle reflexes and hypertonia in hyperekplexia.
Immunogen:
The immunogen for anti-GLRA1 antibody: synthetic peptide derected towards the middle region of human GLRA1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: TMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKHYNTGKFTCIE
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/1/14

Related Post