Anti-GRM6 antibody produced in rabbit

Product Name: Anti-GRM6 antibody produced in rabbit

Synonym: Anti-Glutamate receptor, metabotropic 6

Product Type: Chemical

CAS NO: 90-45-9Carboxypeptidase inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1  mg/mL
Conjugate: unconjugated
Form: lyophilized powder
Mol wt: mol wt 95 kDa
NCBI accession no.
NP_000834
species reactivity
rabbit, rat, rabbit, canine, mouse, guinea pig, horse, human
Storage temp.: −20°C
Application: Rabbit Anti-GRM6 antibody can be used for western blot applications at a concentration of 0.5μg/ml.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
General description: GRM6 is an excitatory neurotransmitter in the central nervous system that stimulates glutamate receptors. GRM6 mutations have been linked to night blindness.
Rabbit Anti-GRM6 antibody recognizes rabbit, canine, chicken, human, mouse, and rat GRM6.
Immunogen:
The immunogen for anti-GRM6 antibody: synthetic peptide derected towards the C terminal of human GRM6
Physical Form: Lyophilized from PBS buffer with 2% sucrose
Sequence:
Synthetic peptide located within the following region: ITFSLTSLQVVGMIAWLGARPPHSVIDYEEQRTVDPEQARGVLKCDMSDL
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/331/3/1104