Product Name: Anti-GTF2E1 antibody produced in rabbit

Synonym: Anti-General transcription factor IIE, polypeptide 1, α 56 kDa

Product Type: Chemical

CAS NO: 1236208-20-0Angiotensin-converting Enzyme (ACE) inhibitors
antibody Form: affinity isolated antibody
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 49 kDa
NCBI accession no.
NP_005504
Shipped in: wet ice
species reactivity
mouse, horse, guinea pig, bovine, rat, rabbit, canine
Storage temp.: −20°C
Application: Anti-GTF2E1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.2 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions:
GTF2E1 is a subunit of General transcription factor IIE, an RNA polymerase II transcription factor that is essential for transcription initiation and promoter escape.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-GTF2E1 antibody: synthetic peptide derected towards the C terminal of human GTF2E1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: VADDPIVMVAGRPFSYSEVSQRPELVAQMTPEEKEAYIAMGQRMFEDLFE
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/3/749

Related Post