Anti-GTF2H2 antibody produced in rabbit

Product Name: Anti-GTF2H2 antibody produced in rabbit

Synonym: Anti-General transcription factor IIH, polypeptide 2, 44 kDa

Product Type: Chemical

CAS NO: 1194506-26-7ATGL inhibitors
antibody Form: IgG fraction of antiserum
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 44 kDa
NCBI accession no.
NP_001035955
Shipped in: wet ice
species reactivity
human, canine, mouse, horse, zebrafish
Storage temp.: −20°C
Application: Rabbit polyclonal anti-GTF2H2 antibody is used to tag general transcription factor IIH, polypeptide 2, 44 kDa for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of general transcription factor IIH, polypeptide 2, 44 kDa in the function of the RNA polymerase II transcription initiation factor IIH. Anti-GTF2H2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
General description: General transcription factor IIH, polypeptide 2, 44 kDa (GTF2H2) is the 44 kDa subunit of RNA polymerase II transcription initiation factor IIH which is involved in basal transcription, transcription from initiation to elongation and nucleotide excision repair processes. Transcription factor IIH (TFIIH) is eukaryotic multiprotein complex.
Immunogen:
The immunogen for anti-GTF2H2 antibody: synthetic peptide derected towards the C terminal of human GTF2H2
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: CELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGC
Specificity:
Rabbit polyclonal anti-GTF2H2 antibody reacts with bovine, chicken, human, canine, mouse, rat, and zebrafish general transcription factor IIH, polypeptide 2, 44 kDa proteins.
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/3/758