Product Name: Anti-HOXA10 (AB2) antibody produced in rabbit

Synonym: Anti-Homeobox A10

Product Type: Chemical

CAS NO: 349085-82-1Glucokinase inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 41 kDa
NCBI accession no.
NP_714926
Shipped in: wet ice
species reactivity
rabbit, pig, canine, mouse, bovine, human
Storage temp.: −20°C
Application: Rabbit polyclonal anti-HOXA10 antibody is used to tag homeobox A10 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of homeobox A10 in hematopoiesis involving the expansion of myeloid progenitor populations and the development of acute myeloid leukemia (AML). Anti-HOXA10 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Biochem/physiol Actions:
HOXA10 is an important regulator of embryogenesis and lineage determination of hematopoietic progenitor cells. In primates, HOXA10 maintains uterine homeosis to regulate receptivity and implantation by synchronizing the maternal and embryonic signaling on the endometrial cells.
General description: Homeobox A10 (HOXA10) is a homeodomain transcription factor involved in definitive hematopoiesis and implicated in the pathogenesis of acute myeloid leukemia (AML). HOXA10 facilitates myeloid progenitor expansion/proliferation while impeding myeloid differentiation. Sustained HoxA10expression during differentiation has been described in poor prognosis human acute myeloid leukemia (AML).
General description: Rabbit polyclonal anti-HOXA10 antibody reacts with rabbit, pig, canine, mouse, bovine, human, and rat homeobox A10 transcription factors.
Immunogen:
The immunogen for anti-HOXA10 antibody: synthetic peptide derected towards the N terminal of human HOXA10
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: SLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRL
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/3/866

Related Post