Product Name: Anti-HSFY1 antibody produced in rabbit

Synonym: Anti-Heat shock transcription factor, Y-linked 1

Product Type: Chemical

CAS NO: 33996-33-7Quinones inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 45 kDa
NCBI accession no.
NP_689797
Shipped in: wet ice
species reactivity
bovine, mouse, human, rat
Storage temp.: −20°C
Biochem/physiol Actions:
HSFY1 is a member of transcription activators for heat shock proteins. The gene encoding HSFY1 localizes to chromosome Y in humans and has a minor role in male fertility and a possible role in spermatogenesis.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-HSFY1 antibody: synthetic peptide derected towards the N terminal of human HSFY1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: SWDENGTCIVINEELFKKEILETKAPYRIFQTDAIKSFVRQLNLYGFSKI
RIDADR: NONH for all modes of transport
WGK Germany: 2
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/337/2/524

Related Post