Anti-HSPB1 (AB1) antibody produced in rabbit

Product Name: Anti-HSPB1 (AB1) antibody produced in rabbit

Synonym: Anti-Heat shock 27 kDa protein 1

Product Type: Chemical

CAS NO: 374913-63-0Glucocorticoid Receptor inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 23 kDa
NCBI accession no.
NP_001531
Shipped in: wet ice
species reactivity
human
Storage temp.: −20°C
Application: Anti-HSPB1 (AB1) antibody is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
HSPB1 is a molecular chaperone that protects the mammalian cells against toxicity, oxidative damage and damage caused by aberrantly folded proteins. Phosphorylation of HSBP1 is mediated by growth factors, oxidative stress, heat shock and tumor necrosis factor. Mutations in this gene have been identified in motor neuronopathies as HSPB1 protein mediates neuronal survival and neurite growth.
General description: HSPB1 (Hsp27) belongs to the family of small heat shock proteins that are overexpressed in response to cellular stress. It is rapidly phosphorylated and under the control of several signal transduction pathways.
Immunogen:
The immunogen for anti-HSPB1 antibody: synthetic peptide derected towards the C terminal of human HSPB1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: SLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/1/3