Product Name: Anti-IRF2 (AB2) antibody produced in rabbit

Synonym: Anti-Interferon Regulatory factor 2

Product Type: Chemical

CAS NO: 178946-89-9Hexokinase inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 39 kDa
NCBI accession no.
NP_002190
Shipped in: wet ice
species reactivity
rat, mouse, bovine, canine, sheep, guinea pig, horse, human
Storage temp.: −20°C
Application: Anti-IRF2 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 5 microg/ml.
Biochem/physiol Actions:
IRFs bind to the cis elements within type 1 IFN and IFN-inducible genes. IRF-1 and -2 have antagonistic effects and any imbalance in the activities results in hematopoietic neoplasms. IRF-2 transcriptionally activates VCAM-1 in the muscle cells and is important for skeletal myogenesis.
General description: Interferon regulatory factors are transcription factors that regulate the expression of interferon system. IRF-1 is a transcription activator whereas IRF-2 represses the activity of IRF-1.
Immunogen:
The immunogen for anti-IRF2 antibody: synthetic peptide derected towards the N terminal of human IRF2
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: IEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEP
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/3/893

Related Post