Product Name: Anti-KCTD13 antibody produced in rabbit

Synonym: Anti-Potassium channel tetramerisation domain containing 13

Product Type: Chemical

CAS NO: 1404095-34-6Somatostatin Receptor inhibitors
antibody Form: affinity isolated antibody
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 36 kDa
NCBI accession no.
NP_849194
Shipped in: wet ice
species reactivity
rat, rabbit, human, canine, mouse, bovine
Storage temp.: −20°C
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
General description: KCTD13 is a BTB/POZ domain-containing protein and is a subunit of the BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex. This complex is involved in regulation of the cytoskeleton.
Immunogen:
The immunogen for anti-KCTD13 antibody: synthetic peptide derected towards the N terminal of human KCTD13
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE
RIDADR: NONH for all modes of transport
WGK Germany: 2
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/336/2/533

Related Post