Anti-KRT14 antibody produced in rabbit

Product Name: Anti-KRT14 antibody produced in rabbit

Synonym: Anti-Keratin 14 (epidermolysis bullosa simplex, Dowling-Meara, Koebner)

Product Type: Chemical

CAS NO: 491833-29-5VEGFR inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 52 kDa
NCBI accession no.
NP_000517
Shipped in: wet ice
species reactivity
rabbit, guinea pig, rat, mouse
Storage temp.: −20°C
Application: Anti-KRT14 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.
Biochem/physiol Actions:
Keratins are abundantly present structural proteins in epithelial cells. Keratins 5 and 14 are primary structural proteins of stratifying epithelia. Mutations in K14 gene or defects in K5-K14 network results in Epidermolysis bullosa simplex, a condition characterized by superficial bullous lesions on skin epithelia.
Immunogen:
The immunogen for anti-KRT14 antibody: synthetic peptide derected towards the C terminal of human KRT14
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: DAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/1/87