Anti-L3MBTL2 (AB1) antibody produced in rabbit

Product Name: Anti-L3MBTL2 (AB1) antibody produced in rabbit

Synonym: Anti-l(3)mbt-like 2 (Drosophila)

Product Type: Chemical

CAS NO: 1491152-26-1Others inhibitors
antibody Form: IgG fraction of antiserum
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 79 kDa
NCBI accession no.
NP_113676
Shipped in: wet ice
species reactivity
canine, bovine, rat, mouse, rabbit, human, guinea pig, horse
Storage temp.: −20°C
Application: Rabbit Anti-L3MBTL2 (AB1) antibody can be used for western blot (0.625μg/ml) and immunohistochemical (4-8μg/ml, using paraffin-embedded tissues) assays.
General description: L(3)mbt-like 2 (L3MBTL2) is known to associate with histone deacetylase 3 (HDAC3). HDAC3 and L3MBTL2 are involved in histone deacetylation and transcriptional repression.
Rabbit Anti-L3MBTL2 (AB1) antibody recognizes canine, bovine, rat, and human L3MBTL2.
Immunogen:
The immunogen for anti-L3MBTL2 antibody: synthetic peptide derected towards the C terminal of human L3MBTL2
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: EYDQWVDCESPDIYPVGWCELTGYQLQPPVAAEPATPLKAKEATKKKKKQ
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/2/571