Product Name: Anti-MARVELD3 antibody produced in rabbit

Synonym: Anti-FLJ32280; Anti-MARVD3; Anti-MARVEL domain containing 3; Anti-MRVLDC3

Product Type: Chemical

CAS NO: 97207-47-1Clinical_Compound_Library inhibitors
antibody Form: affinity isolated antibody
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 46 kDa
NCBI accession no.
NP_001017967
Shipped in: wet ice
species reactivity
bovine, guinea pig, human, rat, rabbit, canine, mouse
Storage temp.: −20°C
Application: Anti-MARVELD3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.
Biochem/physiol Actions:
MARVEL domain containing 3 (MARVELD3) is a transmembrane protein belonging to the occludin family that interacts with occluding and tricellulin at the tight junctions. It colocalizes with occludin at the tight junctions in epithelial cells of intestine and cornea. MARVELD3 determines the paracellular permeability properties of the epithelial cells.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-MARVELD3 antibody: synthetic peptide derected towards the middle region of human MARVELD3
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: SYFVLAGFSASFSSGGGFGNNYYSPFEGTELEQVRQLDQQYTILRSPLIY
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/353/1/2

Related Post