Product Name: Anti-MMP10 antibody produced in rabbit

Synonym: Anti-Matrix metallopeptidase 10 (stromelysin 2)

Product Type: Chemical

CAS NO: 1346527-98-7Adenylate Cyclase inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 54 kDa
NCBI accession no.
NP_002416
Shipped in: wet ice
species reactivity
human
Storage temp.: −20°C
Application: Anti-MMP10 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.
Biochem/physiol Actions:
MMP10 (stromelysin 2) is an important moderator of migration and invasion of macrophages by the degradation of extracellular matrix. The activity of MMP10 produced by tumor cells maintains initiation and metastasis of tumor and is essential to maintain the stem cell-like properties of lung cancer cells.
General description: MMPs are a family of zinc-dependent endopeptidases that have functions in immunity and tissue repair. The activity of MMPs is strictly regulated by endogenous tissue inhibitors of MMPs.
Immunogen:
The immunogen for anti-MMP10 antibody: synthetic peptide derected towards the N terminal of human MMP10
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MMHLAFLVLLCLPVCSAYPLSGAAKEEDSNKDLAQQYLEKYYNLEKDVKQ
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/1/2.3

Related Post