Product Name: Anti-MTCH1 antibody produced in rabbit

Synonym: Anti-CGI-64; Anti-MGC131998; Anti-Mitochondrial carrier homolog 1 (C. elegans); Anti-PIG60; Anti-PSAP

Product Type: Chemical

CAS NO: 638-94-8PKD inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 40 kDa
NCBI accession no.
NP_055156
Shipped in: wet ice
species reactivity
guinea pig, mouse, rat, rabbit, bovine, human, horse, canine
Storage temp.: −20°C
Application: Anti-MTCH1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions:
MTCH1 [Mitochondrial carrier homolog 1 (C. elegans)] gene encodes a multi-pass membrane protein that belongs to mitochondrial carrier family and is localized in mitochondrion inner membrane. MTCH1 stimulates apoptosis independent of the proapoptotic proteins Bax and Bak.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-MTCH1 antibody: synthetic peptide derected towards the C terminal of human MTCH1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: NNCGLQAGLPPYSPVFKSWIHCWKYLSVQGQLFRGSSLLFRRVSSGSCFA
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/356/2/397

Related Post