Product Name: Anti-MTTP antibody produced in rabbit

Synonym: Anti-ABL; Anti-MGC149819; Anti-MGC149820; Anti-MTP; Anti-Microsomal triglyceride transfer protein

Product Type: Chemical

CAS NO: 162652-95-1Motilin Receptor inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1  mg/mL
Conjugate: unconjugated
Form: lyophilized powder
Mol wt: mol wt 97 kDa
NCBI accession no.
NP_000244
species reactivity
bovine, mouse, rat, canine, horse, rabbit, pig, human, guinea pig
Storage temp.: −20°C
Application: Anti-MTTP polyclonal antibody is used to tag microsomal triglyceride transfer protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of microsomal triglyceride transfer protein in the transfer of lipids onto apolipoprotein B.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
General description: Microsomal triglyceride transfer protein (MTP), an endoplasmic reticulum chaperone that loads lipids onto apolipoprotein B, resides in the endoplasmic reticulum of hepatocytes. Microsomal triglyceride transfer protein (MTP) and protein disulfide isomerase (PDI) Form a transmembrane heterodimeric complex called the microsomal triglyceride transfer protein which transfers phospholipids, triglycerides and cholesterol esters from liver cells into the plasma.
Immunogen:
The immunogen for anti-MTTP antibody: synthetic peptide derected towards the N terminal of human MTTP
Physical Form: Lyophilized from PBS buffer with 2% sucrose
Sequence:
Synthetic peptide located within the following region: MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK
Specificity:
Anti-MTTP polyclonal antibody bovine, canine, pig, human, mouse, rat, and chicken microsomal triglyceride transfer proteins.
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/351/3/484.2

Related Post