Product Name: Anti-MyC (AB1) antibody produced in rabbit

Synonym: Anti-Myc protein

Product Type: Chemical

CAS NO: 170846-89-6PERK inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 49 kDa
NCBI accession no.
NP_002458
Shipped in: wet ice
species reactivity
human, mouse, canine, rat
Storage temp.: −20°C
Application: Protein lysates of mouse forebrains were analyzed by western blot using rabbit anti-myc. In addition, immunocytochemistry of PC12 cells fixed in 4% paraFormaldhyde was perFormed using rabbit anti-myc at a 1:500 dilution and 4 degrees incubation overnight.
Biochem/physiol Actions:
MyC is an immediate early response protein that is regulated by multiple signal transduction pathways. It is a highly amplified oncogene in many human cancers and is commonly found altered by chromosomal translocations. MyC plays a role in tumor initiation, proliferation of cells and tumor maintenance.
Immunogen:
The immunogen for anti-MYC antibody: synthetic peptide derected towards the C terminal of human MYC
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: APKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/327/3/969

Related Post