Product Name: Anti-NFKBIA antibody produced in rabbit

Product Type: Chemical

CAS NO: 179756-58-2Gutathione S-transferase inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 36 kDa
NCBI accession no.
NP_065390
Shipped in: wet ice
species reactivity
pig, human
Storage temp.: −20°C
Application: Anti-NFKBIA antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Biochem/physiol Actions:
NFKBIA (IκBα) is a member of NF-κB inhibitor family of proteins that interacts with Rel dimers and inhibits the entry of NF-κB complexes into the nucleus. It represses the transcriptional activation of NF-κB target genes that are involved in inflammatory processes. Polymorphisms within NFKBIA gene results in constitutive activation of NF-κB and increases the risk of hepatocellular carcinoma. Silenced expression of NFKBIA has been observed in lung adenocarcinoma patients with no history of smoking.
Immunogen:
The immunogen for anti-NFKBIA antibody: synthetic peptide derected towards the N terminal of human NFKBIA
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQ
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/3/882

Related Post