Product Name: Anti-NR1I2 (AB1) antibody produced in rabbit

Synonym: Anti-Nuclear receptor subfamily 1, group I, member 2

Product Type: Chemical

CAS NO: 112457-95-1CaMK inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 54 kDa
NCBI accession no.
NP_071285
Shipped in: wet ice
species reactivity
pig, horse, rabbit, canine, human, mouse, bovine, rat, guinea pig, rabbit
Storage temp.: −20°C
Application: Rabbit Anti-NR1I2 antibody is suitable for western blot applications at a concentration of 5 μg/ml.
General description: NR1I2 (PXR) is a transcription factor that belongs to the nuclear receptor family. It associates with the CYP3A4 promoter and the 9-cis retinoic acid receptor RXR. Genetic variations in NR1I2 have been linked to inflammatory bowel disease, lymphoma, and tacrolimus pharmacokinetics.
Rabbit Anti-NR1I2 antibody recognizes pig, canine, human, mouse, rat, bovine, and rabbit NR1I2.
Immunogen:
The immunogen for anti-NR1I2 antibody: synthetic peptide derected towards the C terminal of human NR1I2
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: PQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGI
RIDADR: NONH for all modes of transport
WGK Germany: 2
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/342/2/561

Related Post