Product Name: Anti-NR2F2 antibody produced in rabbit

Synonym: Anti-ARP1; Anti-COUP-TFII; Anti-COUPTFB; Anti-MGC117452; Anti-Nuclear receptor subfamily 2, group F, member 2; Anti-SVP40; Anti-TFCOUP2

Product Type: Chemical

CAS NO: 52239-04-0ATP Synthase inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 45 kDa
NCBI accession no.
NP_066285
Shipped in: wet ice
species reactivity
mouse, bovine, pig, sheep, canine, zebrafish, human, rat, rabbit
Storage temp.: −20°C
Application: Anti-NR2F2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
NR2F2 is an orphan nuclear receptor that plays an important role in metabolism and development. The crosstalk between NR2F2 and the transcription factor HNF4α is involved in regulation of insulin secretion and maintenance of glucose homeostasis. NR2F2 collaborates with OCT4 and miR-302 in differentiation of human embryonic stem cells and specification of neural ectoderm during development.
Immunogen:
The immunogen for anti-NR2F2 antibody: synthetic peptide derected towards the N terminal of human NR2F2
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: KVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEP
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/2/598

Related Post