Product Name: Anti-OTX1 (AB2) antibody produced in rabbit

Synonym: Anti-FLJ38361; Anti-MGC15736; Anti-Orthodenticle homeobox 1

Product Type: Chemical

CAS NO: 1628316-74-4LXR inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 37 kDa
NCBI accession no.
NP_055377
Shipped in: wet ice
species reactivity
bovine, mouse, guinea pig, canine, human, rat, zebrafish
Storage temp.: −20°C
Application: Anti-OTX1 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
OTX1 is a homeodoamin-containing transcription factor that is required for the development of brain and sensory organs. Overexpression of OTX1 has been observed in large B-cell lymphomas, Burkitt lymphoma, and high-grade follicular lymphomas.
Immunogen:
The immunogen for anti-OTX1 antibody: synthetic peptide derected towards the N terminal of human OTX1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: KINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVRESSGSES
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/3/940

Related Post