Product Name: Anti-PACSIN1 antibody produced in rabbit

Synonym: Anti-KIAA1379; Anti-Protein kinase C and casein kinase substrate in neurons 1

Product Type: Chemical

CAS NO: 17696-69-4Bcr-Abl inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 51 kDa
NCBI accession no.
NP_065855
Shipped in: wet ice
species reactivity
goat, rat, mouse, pig, canine, human, horse, rabbit
Storage temp.: −20°C
Application: Anti-PACSIN1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.
Biochem/physiol Actions:
PACSIN1 is a neuron-specific member of PACSIN family, specifically expressed in human and mouse plasmacytoid dendritic cells. PACSIN1 interacts with tubulin and regulates membrane deFormation, linking membrane trafficking and actin organization. It binds with Tau protein in axon and regulates axonal elongation.
Immunogen:
The immunogen for anti-PACSIN1 antibody: synthetic peptide derected towards the C terminal of human PACSIN1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: HTTTKKEKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEW
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/1/314

Related Post