Anti-PARP2 antibody produced in rabbit

Product Name: Anti-PARP2 antibody produced in rabbit

Synonym: Anti-Poly(ADP-ribose) polymerase family, member 2

Product Type: Chemical

CAS NO: 16485-10-2Protein Tyrosine Kinase_RTK inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1  mg/mL
Conjugate: unconjugated
Form: lyophilized powder
Mol wt: mol wt 61 kDa
NCBI accession no.
NP_005475
species reactivity
human, mouse, rabbit, bovine, guinea pig, canine, horse
Storage temp.: −20°C
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
General description: PARP2 is a poly (ADP-ribose) polymerase that catalyzes the post-translational modification of proteins by the addition of multiple ADP-ribose moieties. Parp2 plays a role in the base excision repair pathway following DNA damage.
Immunogen:
The immunogen for anti-PARP2 antibody: synthetic peptide derected towards the middle region of human PARP2
Physical Form: Lyophilized from PBS buffer with 2% sucrose
Sequence:
Synthetic peptide located within the following region: LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/333/3/883