Product Name: Anti-PAX4 antibody produced in rabbit

Synonym: Anti-Paired box gene 4

Product Type: Chemical

CAS NO: 1649-18-9LRRK2 inhibitors
antibody Form: affinity isolated antibody
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 37 kDa
NCBI accession no.
NP_006184
Shipped in: wet ice
species reactivity
rat, canine, guinea pig, rabbit, horse, rabbit, human, mouse
Storage temp.: −20°C
Application: Rabbit Anti-PAX4 antibody can be used for western blot applications at a concentration of 0.5-2.0μg/ml. It can also be used for IHC at 4-8μg/ml using paraffin-embedded tissues.
Application: Rabbit polyclonal anti-PAX4 antibody is used to tag paired box gene 4 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of paired box gene 4 in the differentiation, expansion and survival of pancreatic insulin-producing β cells.
General description: Paired box (PAX) genes are tissue specific homeodomain transcription factors involved in fetal and early animal tissue and cell specification and processes such as limb regeneration. Paired box gene 4 (PAX4) participates in pancreatic islet development and the differentiation of insulin-producing β cells. PAX4) is indispensable for the establishment of the β-cell lineage during development and for mature β-cell expansion and survival.
General description: Rabbit polyclonal anti-PAX4 antibody reacts with canine, rabbit, human, mouse, and rat paired box gene 4 transcription factors.
Immunogen:
The immunogen for anti-PAX4 antibody: synthetic peptide derected towards the middle region of human PAX4
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/330/3/669.2

Related Post