Product Name: Anti-PCNA antibody produced in rabbit

Synonym: Anti-MGC8367; Anti-Proliferating cell Nuclear antigen

Product Type: Chemical

CAS NO: 248919-64-4G-quadruplex inhibitors
antibody Form: IgG fraction of antiserum
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1  mg/mL
Conjugate: unconjugated
Form: lyophilized powder
Mol wt: mol wt 29 kDa
NCBI accession no.
NP_872590
species reactivity
mouse, zebrafish, bovine, rat, human, canine
Storage temp.: −20°C
Application: Anti-PCNA antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Application: Western blot of purified proteins following co-immunoprecipitation studies was perFormed using monoclonal anti-PCNA at the primary antibody.
Biochem/physiol Actions:
PCNA (proliferating cell nuclear antigen) is a factor of DNA polymerase δ, required for DNA synthesis during the replication process. It is also important in chromatin remodeling, DNA repair, cell cycle control and cohesion between sister chromatids.
Immunogen:
The immunogen for anti-PCNA antibody: synthetic peptide derected towards the C terminal of human PCNA
Physical Form: Lyophilized from PBS buffer with 2% sucrose
Sequence:
Synthetic peptide located within the following region: LNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/327/3/872