Product Name: Anti-PRKCZ antibody produced in rabbit

Synonym: Anti-PKC2; Anti-Protein kinase C, zeta

Product Type: Chemical

CAS NO: 9041-93-4Apoptosis_Compound_Library inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 45 kDa
NCBI accession no.
NP_002735
Shipped in: wet ice
species reactivity
canine, rat, horse, bovine, rabbit, guinea pig, mouse, rabbit, human
Storage temp.: −20°C
Application: Anti-PRKCZ polyclonal antibody is used to tag protein kinase C, zeta for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of protein kinase C, zeta in insulin and glucose signaling and sarcomeric proteins function.
Biochem/physiol Actions:
PRKCZ (Protein kinase C ζ) is involved in a variety of cellular processes including cell proliferation, cell motility, and cell survival. It acts as a regulatory molecule in the insulin signaling pathways. It has been suggested that PRKCZ perForms downstream of phosphatidylinositol 3-kinase (PI 3-kinase) in the insulin signal pathway, for the translocation of GLUT4-encoded protein. It has also been reported that PRKCZ may act as a negative regulator by phosphorylating insulin receptor substrate-1 (IRS-1), which restricts its ability to activate phosphatidylinositol 3-kinase in response to insulin. It has been documented that PRKCZ might be involved in the pathogenesis of type 2 diabetes mellitus (T2DM). PRKCZ also has been reported to be part of various signaling pathways such as ERK/MAPK activation pathway, p70 ribosomal S6 kinase signaling cascade, activation of transcription factor NF-κB. It also plays a role in the regulation of cell polarity. Study predicts that PRKCZ may also have a role in the ovarian cancer progression.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
General description: PRKCZ (Protein kinase C ζ) is a chromosome 1p36.33-p36 located gene belonging to the PKC family of serine/threonine kinases and the aPKC subfamily.
Immunogen:
The immunogen for anti-PRKCZ antibody: synthetic peptide derected towards the N terminal of human PRKCZ
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKP
Specificity:
Anti-PRKCZ polyclonal antibody reacts with human, mouse, rat, canine, bovine, and rabbit protein kinase C, zeta proteins.
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/350/3/479.4

Related Post