Product Name: Anti-RAB3A antibody produced in rabbit

Synonym: Anti-RAB3A, member RAS oncogene family

Product Type: Chemical

CAS NO: 1616113-45-1c-Kit inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 25 kDa
NCBI accession no.
NP_002857
Shipped in: wet ice
species reactivity
mouse, rat, human, canine, guinea pig, bovine, sheep
Storage temp.: −20°C
Application: Anti- RAB3D antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
Rab3A is a synaptic vesicle-associated GTPase that regulates Ca+2-dependent exocytosis. It is ubiquitously present in nervous system and in the acrosomal region of human sperm. Rab3A Forms complex with RIM and Munc13 proteins to regulate synaptic vesicles docking and acrosomal exocytosis. It is a regulator of Ca+2-dependent release of α-melanocyte stimulating hormone.
Immunogen:
The immunogen for anti-RAB3A antibody: synthetic peptide derected towards the C terminal of human RAB3A
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: NVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/1/335

Related Post