Anti-RBM10 (AB1) antibody produced in rabbit

Product Name: Anti-RBM10 (AB1) antibody produced in rabbit

Synonym: Anti-RNA binding motif protein 10

Product Type: Chemical

CAS NO: 522-12-3Clinical_Compound_Library inhibitors
antibody Form: IgG fraction of antiserum
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 104 kDa
NCBI accession no.
NP_005667
Shipped in: wet ice
species reactivity
canine, rabbit, mouse, rat, guinea pig, horse, bovine, human
Storage temp.: −20°C
Application: Rabbit Anti-RBM10 (AB1) antibody can be used for western blot (1.4μg/ml) and immunohistochemistry (4-8μg/ml, using paraffin-embedded tissues) applications.
General description: The RNA Binding Motif 10 (RBM10) is similar to RBM5 and functions as a modulator of apoptosis. RBM10 can also act as an RNA binding protein and regulate the co-transcriptional modification of pre-mRNA.
Rabbit Anti-RBM10 (AB1) antibody recognizes canine, mouse, rat, and human RBM10.
Immunogen:
The immunogen for anti-RBM10 antibody: synthetic peptide derected towards the N terminal of human RBM10
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MDYRSYPREYGSQEGKHDYDDSSEEQSAEDSYEASPGSETQRRRRRRHRH
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/2/625