Anti-RGS3 antibody produced in rabbit

Product Name: Anti-RGS3 antibody produced in rabbit

Synonym: Anti-C2PA; Anti-FLJ20370; Anti-FLJ31516; Anti-FLJ90496; Anti-PDZ-RGS3; Anti-RGP3; Anti-Regulator of G-protein signaling 3

Product Type: Chemical

CAS NO: 33996-33-7Histone Demethylase inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 101 kDa
NCBI accession no.
NP_066929
Shipped in: wet ice
species reactivity
rat, rabbit, human, horse, mouse, bovine, guinea pig, canine
Storage temp.: −20°C
Application: Anti-RGS3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml.
Biochem/physiol Actions:
Regulator of G-protein signaling-3 (RGS3) accelerates the GTPase activity of G(i) and G(q) subunits. It interacts with the Smad transcription factors that are activated by TGF-β and prevents the heteromerization of Smad3 and Smad4. This results in inhibition of transcriptional activity of Smads and inhibition of TGF-β-induced differentiation of myofibroblasts. In sensory neurons, RGS3 mediates the termination of G protein signaling by calcium influx through voltage-gated channels. The role of RGS3 in collaboration with Ephrin-B is important in the maintenance of the neural progenitor cells.
Immunogen:
The immunogen for anti-RGS3 antibody: synthetic peptide derected towards the C terminal of human RGS3
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/1/19