Anti-RNASEL antibody produced in rabbit

Product Name: Anti-RNASEL antibody produced in rabbit

Synonym: Anti-Ribonuclease L (2′,5′-oligoisoadenylate synthetase-dependent)

Product Type: Chemical

CAS NO: 1218777-13-9Cholecystokinin Receptor inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 84 kDa
NCBI accession no.
NP_066956
Shipped in: wet ice
species reactivity
human, bovine, pig, horse, canine
Storage temp.: −20°C
Application: Anti-RNASEL antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
Endoribonuclease L (RNaseL) is an enzyme activated by its allosteric activator 2′,5′-linked oligoadenylates (2-5A). The 2-5A/RNaseL system is induced by interferons and cleaves single-stranded RNA molecules in U-rich sequences. This pathway mediates immunomodulatory, antiviral and antiproliferative effects.
Immunogen:
The immunogen for anti-RNASEL antibody: synthetic peptide derected towards the C terminal of human RNASEL
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGA
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/1/256