Product Name: Anti-RORA (AB2) antibody produced in rabbit

Synonym: Anti-MGC119326; Anti-MGC119329; Anti-NR1F1; Anti-RAR-related orphan receptor A; Anti-ROR1; Anti-ROR2; Anti-ROR3; Anti-RZRA

Product Type: Chemical

CAS NO: 62-31-7GPCR_G Protein inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 62 kDa
NCBI accession no.
NP_599022
Shipped in: wet ice
species reactivity
bovine, sheep, zebrafish, human, rat, rabbit, canine, horse, guinea pig, mouse, goat
Storage temp.: −20°C
Application: Anti-RORA (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.
Biochem/physiol Actions:
Retinoic acid related orphan receptor A (RORA), a member of the retinoid-related orphan family of nuclear receptors, is a ligand-dependent transcription factor. RORA is widely expressed and enhances p53-dependent apoptosis. RORA is important for the development of the cerebellum and it is required for the maturation of photoreceptors in the retina.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-RORA antibody: synthetic peptide derected towards the N terminal of human RORA
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRC
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/354/1/18

Related Post