Anti-RUNX1 antibody produced in rabbit

Product Name: Anti-RUNX1 antibody produced in rabbit

Synonym: Anti-Runt-elated transcription factor 1 (acute myeloid leukemia 1; aml1 oncogene)

Product Type: Chemical

CAS NO: 448947-81-7Glucagon Receptor inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 12 kDa
NCBI accession no.
NP_001001890
Shipped in: wet ice
species reactivity
rabbit, zebrafish, rat, guinea pig, mouse, horse, canine, bovine, human
Storage temp.: −20°C
Application: Anti-RUNX1 antibody produced in rabbit is suitable for western blot.
Biochem/physiol Actions:
RUNX1 (Runt-related transcription factor 1) plays a vital role in tumour suppression and oncogenic activities. In hematopoiesis, it is involved in hematopoietic development, hematopoietic stem cell homeostasis, and various blood malignancies. It may have clinicopathological impact on the proliferation of human bone marrow cells used in transplantation therapy.
General description: Runt-related transcription factor 1 (RUNX1) is a transcription factor that plays an important role in hematopoiesis, osteogenesis and neurogenesis. It is a member of Runt-related transcription factors (RUNXs). It was first identified as a component of Polyomavirus enhancer binding protein 2 (PEBP2) and Moloney murine leukemia virus enhancer core binding factor (CBF). Three isoForms of the protein have been identified: RUNX1a, RUNX1b and RUNX1c. Structurally, it consists of Runt domain at the N-terminal region.
Immunogen:
The immunogen for anti-RUNX1 antibody: synthetic peptide derected towards the N terminal of human RUNX1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: KMPAAPRGPAQGEAAARTRSRDASTSRRFTPPSTALSPGKMSEALPLGAP
RIDADR: NONH for all modes of transport
WGK Germany: 2
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/34/4/425