Product Name: Anti-SLC16A8 antibody produced in rabbit

Synonym: Anti-MCT3; Anti-Solute carrier family 16, member 8 (monocarboxylic acid transporter 3)

Product Type: Chemical

CAS NO: 147084-10-4GlyT inhibitors
antibody Form: IgG fraction of antiserum
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Mol wt: mol wt 52 kDa
NCBI accession no.
NP_037488
packaging
pkg of 100 μg lyophilized powder

pkg of 100 μL buffered aqueous solution
species reactivity
bovine, mouse, guinea pig, rat, horse, pig, canine, human, rabbit
Storage temp.: −20°C
Application: Anti-SLC16A8 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.
Biochem/physiol Actions:
SLC16A8 (MCT3) is a proton-coupled monocarboxylate transporter that facilitates the movement of lactate across the cell membranes. Mutation in the gene for MCT3 results in altered visual function in mice and has been associated with age-related macular degeneration.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-SLC16A8 antibody: synthetic peptide derected towards the middle region of human SLC16A8
Sequence:
Synthetic peptide located within the following region: RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/351/3/709

Related Post