Product Name: Anti-SLC20A1 antibody produced in rabbit

Synonym: Anti-DKFZp686J2397; Anti-FLJ41426; Anti-GLVR1; Anti-Glvr-1; Anti-PIT1; Anti-PiT-1; Anti-Solute carrier family 20 (phosphate transporter), member 1

Product Type: Chemical

CAS NO: 54910-89-3MEK inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 74 kDa
NCBI accession no.
NP_005406
Shipped in: wet ice
species reactivity
canine, rabbit, horse, human
Storage temp.: −20°C
Application: Anti-SLC20A1 polyclonal antibody is used to tag solute carrier family 20 (phosphate transporter) member 1/gibbon ape leukemia virus 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 20 (phosphate transporter) member 1/gibbon ape leukemia virus 1 protein in Pi homeostasis.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
General description: Solute carrier family 20 (phosphate transporter) member 1/gibbon ape leukemia virus 1 (SLC20A1, GLVR1, PiT-1) is a type III Na+-dependent Pi transporter responsible for the transport of inorganic phosphate (Pi) and maintenance of Pi homeostasis that supports biological processes such as nucleic acid synthesis, tooth mineralization, skeletal development and various signaling cascades.
Immunogen:
The immunogen for anti-SLC20A1 antibody: synthetic peptide derected towards the C terminal of human SLC20A1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDL
Specificity:
Anti-SLC20A1 polyclonal antibody reacts with canine and human solute carrier family 20 (phosphate transporter) member 1 proteins.
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/351/3/654

Related Post