Product Name: Anti-SLC25A46 (AB2) antibody produced in rabbit

Synonym: Anti-Solute carrier family 25, member 46

Product Type: Chemical

CAS NO: 283173-50-2HCV Protease inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 46 kDa
NCBI accession no.
NP_620128
Shipped in: wet ice
species reactivity
horse, zebrafish, human, rabbit, mouse, rat
Storage temp.: −20°C
Application: Anti-SLC25A46 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml.
Biochem/physiol Actions:
SLC25A46 is a mitochondrial phosphate transporter that is widely expressed in human central nervous system. Single nucleotide polymorphisms in the gene encoding this transporter have been implicated in the development of left ventricular hypertrophy.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-SLC25A46 antibody: synthetic peptide derected towards the N terminal of human SLC25A46
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: RSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEP
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/352/1/98

Related Post