Product Name: Anti-SLC30A9 (AB1) antibody produced in rabbit

Synonym: Anti-Solute carrier family 30 (Zinc transporter), member 9

Product Type: Chemical

CAS NO: 108212-75-5DNA Alkylator_Crosslinker inhibitors
antibody Form: affinity isolated antibody
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 63 kDa
NCBI accession no.
NP_006336
Shipped in: wet ice
species reactivity
rat, guinea pig, human, canine, mouse, bovine, horse, zebrafish, rabbit
Storage temp.: −20°C
Application: Rabbit Anti-SLC30A9 (AB1) antibody is suitable for use in western blot assays at a concentration of 0.5-2.0μg/ml. The antibody can also be used for IHC at 4-8μg/ml, using paraffin-embedded tissues.
General description: SLC30A9 is a member of the solute carrier family that may function as a zinc transporter.
Rabbit Anti-SLC30A9 (AB1) antibody recognizes rat, human, canine, mouse, pig, bovine, and zebrafish SLC30A9.
Immunogen:
The immunogen for anti-SLC30A9 antibody: synthetic peptide derected towards the N terminal of human SLC30A9
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: LKQEPLQVRVKAVLKKREYGSKYTQNNFITGVRAINEFCLKSSDLEQLR
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/3/967

Related Post