Product Name: Anti-SLC35A3 antibody produced in rabbit

Synonym: Anti-DKFZp781P1297; Anti-Solute carrier family 35 (UDP-N-acetylglucosamine transporter), member A3

Product Type: Chemical

CAS NO: 862189-95-5ATP Synthase inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 36 kDa
NCBI accession no.
NP_036375
Shipped in: wet ice
species reactivity
bovine, rabbit, canine, human, horse
Storage temp.: −20°C
Application: Anti-SLC35A3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.
Biochem/physiol Actions:
SLC35A3 is a UDP-N-acetylglucosamine transporter present in the membrane of Golgi apparatus that maintains nucleotide-sugar transport. Mutations in the gene encoding this transporter result in Complex Vertebral MalFormation syndrome in cattle.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-SLC35A3 antibody: synthetic peptide derected towards the middle region of human SLC35A3
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: VAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKET
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/351/3/685

Related Post