Product Name: Anti-SMAD6 (AB1) antibody produced in rabbit

Synonym: Anti-SMAD family member 6

Product Type: Chemical

CAS NO: 548-83-4Immunology_Inflammation inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 53 kDa
NCBI accession no.
NP_001136333
Shipped in: wet ice
species reactivity
human, canine, pig, bovine
Storage temp.: −20°C
Application: Anti-SMAD6 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
Smad6 is an inhibitory Smad member that antagonizes the effects of TGF-β and BMP signaling. The mechanism of inhibition involves competing with receptor-regulated Smads. Smad6 inhibits the non-canonical pathway of TGF-β, regulating the activation of p38 MAPK/JNK.
General description: The members of Smad protein family mediate the signal transduction of TGF-β. Signaling via Smad/TGF-β have been implicated in development, homeostasis and cancer development.
Immunogen:
The immunogen for anti-SMAD6 antibody: synthetic peptide derected towards the N terminal of human SMAD6
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: GAPRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKRLKE
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/2/399