Product Name: Anti-SMARCA5 (AB2) antibody produced in rabbit

Synonym: Anti-ISWI; Anti-SNF2H; Anti-SWI/SNF related, matrix associated, actin dependent Regulator of chromatin; Anti-WCRF135; Anti-hISWI; Anti-hSNF2H

Product Type: Chemical

CAS NO: 253426-24-3TGF-(beta) Receptor inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 122 kDa
NCBI accession no.
NP_003592
Shipped in: wet ice
species reactivity
horse, bovine, human, mouse, guinea pig, canine, rat
Storage temp.: −20°C
Application: Anti-SMARCA5 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml.
Biochem/physiol Actions:
SMARCA5 is an ATPase that is a part of several ISWI chromatin remodeling complexes that are involved in DNA double-strand breaks (DSB). It protects the cells against ionizing radiation by regulating the pathways of DSB repair – non-homologous end-joining (NHEJ) and homologous recombination (HR).
Immunogen:
The immunogen for anti-SMARCA5 antibody: synthetic peptide derected towards the N terminal of human SMARCA5
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: AGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTE
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/2/459

Related Post