Product Name: Anti-SNAPC2 (AB1) antibody produced in rabbit

Synonym: Anti-PTFdelta; Anti-SNAP45; Anti-Small Nuclear RNA activating complex, polypeptide 2, 45 kDa

Product Type: Chemical

CAS NO: 140926-75-6Nampt inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 35 kDa
NCBI accession no.
NP_003074
Shipped in: wet ice
species reactivity
human
Storage temp.: −20°C
Application: Anti-SNAPC2 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions:
SNAP45 is a subunit of snRNA activating protein complex (SNAPc), binds to TATA box and regulates RNA polymerase II- and III-dependent transcription of snRNA genes. SNAP45 is essential for progression of mitosis; it binds to centrosomes and spindle midzones during mitotic phases.
Immunogen:
The immunogen for anti-SNAPC2 antibody: synthetic peptide derected towards the middle region of human SNAPC2
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: STEEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVLDLLMSLPEELPL
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/3/976

Related Post