Anti-SREBF2 antibody produced in rabbit

Product Name: Anti-SREBF2 antibody produced in rabbit

Synonym: Anti-SREBP2; Anti-Sterol Regulatory element binding transcription factor 2

MDL Number: MFCD02264111
Product Type: Chemical

CAS NO: 498-02-2CRTH2 (GPR44) inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 124 kDa
NCBI accession no.
NP_004590
Shipped in: wet ice
species reactivity
horse, canine, human, guinea pig, rat, bovine
Storage temp.: −20°C
Application: Anti- SREBF2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Biochem/physiol Actions:
Sterol Regulatory Element-Binding Proteins (SREBPs) are transcription factors that are required for metabolic reprogramming and membrane synthesis in CD8+ T cells during the transition from quiescence to activation. SREBF2 is a transcriptional regulator of genes involved in cholesterol biosynthesis and lipid homeostasis.
Immunogen:
The immunogen for anti-SREBF2 antibody: synthetic peptide directed towards the middle region of human SREBF2
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: PASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRIL
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/1/263