Product Name: Anti-SRF antibody produced in rabbit

Synonym: Anti-Serum response factor (c-fos Serum response element-binding transcription factor)

Product Type: Chemical

CAS NO: 223488-57-1SGLT inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 52 kDa
NCBI accession no.
NP_003122
Shipped in: wet ice
species reactivity
mouse, rat, rabbit, pig, canine, bovine, zebrafish, human
Storage temp.: −20°C
Application: Anti-SRF antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.
Biochem/physiol Actions:
SRF is a transcription factor that binds to CArG box and regulates cellular activities such as migration, differentiation, proliferation, angiogenesis, synaptic activity, inflammation, cell contractility and apoptosis. It regulates VEGF- and FG-mediated signaling during sprouting angiogenesis and actin polymerization. SRF and its cofactors are important for biogenesis of muscle contractile protein.
Immunogen:
The immunogen for anti-SRF antibody: synthetic peptide derected towards the N terminal of human SRF
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: ATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIM
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/3/682

Related Post