Anti-ST3GAL2 antibody produced in rabbit

Product Name: Anti-ST3GAL2 antibody produced in rabbit

Synonym: Anti-Gal-NAc6S; Anti-SIAT4B; Anti-ST3 β-galactoside α-2,3-sialyltransferase 2; Anti-ST3GALII; Anti-ST3GalA.2

Product Type: Chemical

CAS NO: 66085-59-4Phosphatase_Inhibitor_Cocktail_II inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 40 kDa
NCBI accession no.
NP_008858
Shipped in: wet ice
species reactivity
zebrafish, human, mouse, horse, guinea pig, bovine, canine, rat, rabbit
Storage temp.: −20°C
Application: Anti-ST3GAL2 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions:
ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2) gene encodes a type II membrane protein that belongs to the glycosyltransferase family 29. It plays a pivotal role in transfering the sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL2 is a MSGb5 (stage-specific embryonic antigen-4) synthase and increased expression of ST3Gal II facilitates as a marker for renal carcinogenesis.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-ST3GAL2 antibody: synthetic peptide derected towards the C terminal of human ST3GAL2
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/356/1/64