Anti-SUPT3H antibody produced in rabbit

Product Name: Anti-SUPT3H antibody produced in rabbit

Synonym: Anti-Suppressor of Ty 3 homolog (S. cerevisiae)

Product Type: Chemical

CAS NO: 1345982-69-5Aromatase inhibitors
antibody Form: IgG fraction of antiserum
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 36 kDa
NCBI accession no.
NP_003590
Shipped in: wet ice
species reactivity
rabbit, pig, human, goat, rat, guinea pig, bovine, canine, mouse, horse
Storage temp.: −20°C
Application: Anti- SUPT3H antibody produced in rabbit is suitable for western blotting at a concentration of 0.4 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions:
Suppressor of Ty 3 homolog is a Saccharomyces cerevisiae transcription factor that regulates the transcription of RNA polymerase II-transcribed genes.
Immunogen:
The immunogen for anti-SUPT3H antibody: synthetic peptide derected towards the N terminal of human SUPT3H
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSNNANKRQKI
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/2/486