Product Name: Anti-TAF9 antibody produced in rabbit

Synonym: Anti-TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32 kDa

Product Type: Chemical

CAS NO: 1446486-33-415-PGDH inhibitors
antibody Form: affinity isolated antibody
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 19 kDa
NCBI accession no.
NP_057367
Shipped in: wet ice
species reactivity
horse, human, rat, guinea pig, canine, mouse, rabbit, rabbit, bovine,
Storage temp.: −20°C
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
General description: TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa is a subunit of the TFIID complex that is responsible for coordinating binding of RNA polymerase II and initiation of transcription. Taf9 is essential for life and has been shown to both activate and repress distinct sets of genes.
Immunogen:
The immunogen for anti-TAF9 antibody: synthetic peptide derected towards the N terminal of human TAF9
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: GLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVD
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/335/1/2

Related Post