Anti-TAL1 (AB2) antibody produced in rabbit

Product Name: Anti-TAL1 (AB2) antibody produced in rabbit

Synonym: Anti-SCL; Anti-T-cell acute lymphocytic leukemia 1; Anti-TCL5; Anti-Tal-1

Product Type: Chemical

CAS NO: 59729-37-2PDHK inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 34 kDa
NCBI accession no.
NP_003180
Shipped in: wet ice
species reactivity
guinea pig, human, rabbit, rat, mouse, bovine, canine, horse
Storage temp.: −20°C
Application: Anti-TAL1 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 5 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions:
TAL1/SCL regulates osteoclast-differentiation via GATA-2, macrophage colony-stimulating factor, and osteoclast-differentiation factor/osteoprotegerin ligand pathway.
Immunogen:
The immunogen for anti-TAL1 antibody: synthetic peptide derected towards the middle region of human TAL1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: INFLAKLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVL
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/1/1.1