Product Name: Anti-TBL2 antibody produced in rabbit

Synonym: Anti-DKFZP43N024; Anti-MGC134739; Anti-Transducin (β)-like 2; Anti-WBSCR13; Anti-WS-betaTRP

Product Type: Chemical

CAS NO: 937270-47-8DAPK inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 49 kDa
NCBI accession no.
NP_036585
Shipped in: wet ice
species reactivity
human, rabbit, mouse, horse
Storage temp.: −20°C
Application: Anti-TBL2 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions:
TBL2 interacts with TERE1 and the TERE1-TBL2 complex may facilitate the oxidative/nitrosative stress, lipid metabolism and SXR signaling pathways in its role as a tumor suppressor.
General description: TBL2 (transducin (beta)-like 2) gene encodes a protein that belongs to β-transducin family and has four putative WD40-repeats. It is predominantly expressed as a 2.4kb transcript in testis, skeletal muscle, heart and some endocrine tissues and is mapped on to human 7q11.23.
Immunogen:
The immunogen for anti-TBL2 antibody: synthetic peptide derected towards the N terminal of human TBL2
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: RSGRPACQKANGFPPDKSSGSKKQKQYQRIRKEKPQQHNFTHRLLAAALK
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/45/1/65

Related Post