Anti-TCF4 (AB2) antibody produced in rabbit

Product Name: Anti-TCF4 (AB2) antibody produced in rabbit

Synonym: Anti-E2-2; Anti-ITF2; Anti-SEF2; Anti-SEF2-1; Anti-SEF2-1A; Anti-SEF2-1B; Anti-Transcription factor 4

Product Type: Chemical

CAS NO: 879487-87-3STING inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 71 kDa
NCBI accession no.
NP_001077431
Shipped in: wet ice
species reactivity
human, rat, guinea pig, horse, pig, mouse
Storage temp.: −20°C
Application: Anti-TCF4 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml.
Biochem/physiol Actions:
TCF-4 mediates the transFormation of epithelial cells of colon in the absence of APC gene expression. The expression of TCF-4 is required to establish the proliferative progenitors to Form the crypts of embryonic small intestine. TCF-4 collaborates with β-catenin to regulate the colorectal transFormation process. Lack of TCF-4 expression results in developmental delay and intellectual disability termed as Pitt-Hopkins syndrome.
General description: TCF-4 belongs to the Tcf family of transcription factors that activate genes induced by the Wnt pathway.
Immunogen:
The immunogen for anti-TCF4 antibody: synthetic peptide derected towards the N terminal of human TCF4
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: DGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCH
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/2/504