Product Name: Anti-TCF7 (AB1) antibody produced in rabbit

Synonym: Anti-Transcription factor 7 (T-cell specific, HMG-box)

Product Type: Chemical

CAS NO: 5947-49-9sFRP-1 inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 30 kDa
NCBI accession no.
NP_001128323
Shipped in: wet ice
species reactivity
human, guinea pig, mouse, bovine, rabbit, canine, rat, horse
Storage temp.: −20°C
Application: Rabbit Anti-TCF7 antibody is suitable for western blot applications at a concentration of 0.5 μg/ml.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
General description: TCF7 is a transcription factor that modulates the differentiation and self-renewal of multipotential hematopoietic cell lines. Variations in TCF7 have been linked to type I diabetes.
Rabbit Anti-TCF7 antibody recognizes human, mouse, rat, bovine, and canine TCF7.
Immunogen:
The immunogen for anti-TCF7 antibody: synthetic peptide derected towards the N terminal of human TCF7
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: PQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTP
RIDADR: NONH for all modes of transport
WGK Germany: 2
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/335/3/546

Related Post