Product Name: Anti-TMEM118 antibody produced in rabbit

Synonym: Anti-FLJ14627

Product Type: Chemical

CAS NO: 136676-91-0Salt-inducible Kinase (SIK) inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 46 kDa
NCBI accession no.
NP_116203
Shipped in: wet ice
species reactivity
zebrafish, horse, human, mouse, rat, rabbit, guinea pig,
Storage temp.: −20°C
Application: Anti-TMEM118 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
General description: TMEM118 is also known as ring finger protein, transmembrane 2 (RNFT2).
Immunogen:
The immunogen for anti-TMEM118 antibody: synthetic peptide derected towards the N terminal of human TMEM118
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: HGGHRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGL
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/362/1/146

Related Post