Anti-TNFSF12 antibody produced in rabbit

Product Name: Anti-TNFSF12 antibody produced in rabbit

Synonym: Anti-Tumor necrosis factor (ligand) superfamily, member 12

Product Type: Chemical

CAS NO: 90365-57-4Stem Cell_Wnt inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 27 kDa
NCBI accession no.
NP_742086
Shipped in: wet ice
species reactivity
human, mouse, horse
Storage temp.: −20°C
Application: Rabbit polyclonal anti-TNFSF12 antibody is used to tag tumor necrosis factor (ligand) superfamily, member 12/TNF-like weak inducer of apoptosis for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of tumor necrosis factor (ligand) superfamily, member 12/TNF-like weak inducer of apoptosis in the regulation of progenitor cell proliferation, differentiation, and survival through FN14/TWEAK receptor cell signaling pathways. Anti-TNFSF12 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
General description: Rabbit polyclonal anti-TNFSF12 antibody reacts with human, mouse, and canine tumor necrosis factor (ligand) superfamily, member 12/TNF-like weak inducer of apoptosis cytokines.
General description: Tumor necrosis factor (ligand) superfamily, member 12/ TNF-like weak inducer of apoptosis (TNFSF12, APO3L, DR3LG, TWEAK), a tumor necrosis factor (TNF) ligand family cytokine, is a pleiotropic cytokine that mediates its cell signaling effect via binding to the FN14/TWEAK receptor (TWEAKR). TNFSF12/TWEAK, which is expressed in many tissue types, is an inflammatory cytokine that induces chemokines and other proinflammatory cytokines. TNFSF12/TWEAK regulates progenitor cell proliferation, differentiation, and survival in multiple organ systems.
Immunogen:
The immunogen for anti-TNFSF12 antibody: synthetic peptide derected towards the N terminal of human TNFSF12
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: QEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRA
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/1/94